PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID estExt_fgenesh3_pg.C_380020
Common NameCHLNCDRAFT_59405
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
Family G2-like
Protein Properties Length: 725aa    MW: 73630.5 Da    PI: 5.416
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
estExt_fgenesh3_pg.C_380020genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like58.71.3e-183791155
                      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                 k+ +rW + LHe F eav++LGG++ A P +i++ m++  Lt ++vkSHLQk+R+
  estExt_fgenesh3_pg.C_380020 37 KQYVRWDCGLHELFEEAVDELGGAHAAKPANIRDRMGIALLTTAQVKSHLQKHRI 91
                                 5679*************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.2533494IPR017930Myb domain
SuperFamilySSF466894.84E-93592IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.3E-163692IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-153792IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 725 aa     Download sequence    Send to blast
MGEEAPPLAV QPVQPQGASL DEKKQEVIER SFFGPNKQYV RWDCGLHELF EEAVDELGGA  60
HAAKPANIRD RMGIALLTTA QVKSHLQKHR IRVVAENGSK DATEAQARAA AKLLERQKRQ  120
ADSGMVPPRP RGLVPIRGSR QMSGGLGLGG AAAAAAAAAA AGGGDASKRP KRRARKRRAY  180
DDSFSSSGDD EEYGGYGLAQ WEEEELAAEA EGEEELRLAR RPRRARRSGF DSDRGETDGE  240
GLSAGTTTAS PGGGPGGGLE VEALPFAELS RMLTAEGVNV DPATLAGLTQ RRATFVAAAA  300
AAAGLPPPTS VPPPLLPMPA GPGMPLYQSS AEPASTHLPP FFPPNGGAGA GGSISVDGAV  360
ATLNRQVQLE HALLEQSMWV QKLAAEVQEL RNRQRLGLPP PPPDAAALSS PFAVMSQAAF  420
PGAAEPSPPG PAGLTLPPPP PPPQQQQQAF HAQLHPQQQQ QQQQQQQQQS SGNLATCDST  480
LLRLLSSTLG GQVPGLSKQE ASDAAVALLQ GIEAAGAERA AADHAASQQA ARQAEAASAA  540
NAAASLMTCD SGLLRMLSQS LHEAAWQQQP ADGAAASSND AAVQAVAAAA ARLAAEAGEG  600
SLGSTLAAAA AAAAAAASPF GAAAGQALPP PPSLPPTLPP PNLALGGGRP PPPLPQGLGL  660
GLPPPLPGAS GNRQASLDVF NNGLLALGLA GASSASQPRA LSTAEFLRLC SLPGAADLLP  720
PADP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1167175KRPKRRARK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005842922.10.0hypothetical protein CHLNCDRAFT_59405
TrEMBLE1ZTJ70.0E1ZTJ7_CHLVA; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18240.31e-10myb-related protein 1
Publications ? help Back to Top
  1. Blanc G, et al.
    The Chlorella variabilis NC64A genome reveals adaptation to photosymbiosis, coevolution with viruses, and cryptic sex.
    Plant Cell, 2010. 22(9): p. 2943-55
    [PMID:20852019]